• Home
    • About
    • Contact
  • Bitchin’ In The Kitchen
  • Shop
  • Cook
  • Sew
  • Make
  • Clean
  • Glam
  • Home
    • About
    • Contact
  • Bitchin’ In The Kitchen
  • Shop
  • Cook
  • Sew
  • Make
  • Clean
  • Glam

Recipe: Easy Edamame & Chickpea Falafel {Vegan, GF, Bake or Fry}

January 15, 2018
Summary: Oh how I love falafels! There is this kebab truck near me that has the most perfect traditional handmade falafels, served in a wrap. They are honestly amazing! If you look at traditional recipes, you really need to start with dried chickpeas or the mix won’t hold up to the deep frying. This is by no means a traditional recipe at all but is 100% delicious and really quick to prepare. Tinned chickpeas, shelled edamame and a cookie scoop make this practically effortless! Finding frozen & shelled edamame can be tough around here but shelling goes quickly. I just throw about 200g of edamame in their shells into a microwave container with a 1/4 cup water and cook on high for 3-4 mins. Drain and wait for them to cool and then shell.
Then everything is in the food processor and I just use a cookie scoop from there. I used my medium cookie scoop, which you can see alongside an ice cream scoop and a small cookie scoop in this video. You want a scoop holds about 1 1/2 – 2 tablespoons. I use my cookie scoops all the time, they are so handy for anything that needs to be ‘rolled into a ball’. You can buy them in specialist cooking stores or find cheap sets on eBay or Amazon. These falafels are going to get made a lot! We ate ours so quickly because they tasted so, so good. Not a crumb left on the plate! Plus really, really quick and easy and they could work with so many other dishes. We had ours with zucchini rice salad, a green salad and healthy helping of hummus. I could see these as an accompaniment to many sides but also in a more traditional wrap. Either way, this is food love for me!

Ingredients

  • 1 (400g) can chickpeas, rinsed & drained
  • 1 red onion, quartered
  • 1/2 cup edamame, shelled
  • 3 garlic cloves
  • 2 tblsp tahini
  • 2 tablespoon chickpea (besan) flour
  • 1 tsp paprika
  • 1 1/2 tsp cumin
  • 1/2 teaspoon cayenne pepper
  • 1/2 tsp ground coriander
  • 1/4 tsp salt
Instructions
  1. Add everything to the bowl of a food processor and pulse until the ingredients come together. Enough that you don’t have chunks of onion but it’s good to have some chunky texture and not just a paste. Also, chickpea flour tastes foul and bitter uncooked (but is great cooked) so taste at your peril!
  2. Line a baking tray and have it on hand. Either use damp hands to roll into balls or a use a cookie scoop. The scoop is super quick and easy! Set each one on the lined tray. If you are cooking them later, put the tray in the fridge until needed.
  3. I think pan frying is best because you get a nice crust and don’t dry them out but you can also oven cook. To pan fry, heat a little olive oil in a pan over medium low. Fry the falafels in batches, squishing them down a little to form flat sides. Fry for about 5 mins each side, until brown and crispy and cooked though.
  4. If you choose to bake them, put your baking tray in an oven  preheated oven at 190C and bake for 35-40 mins minutes, until golden brown on the outside.
  5. Serve hot or cold. Makes approx 14 falafels
follow
chickpeaeasyedamamefalafelgfgluten freehealthysimplevegan
Share

Main Meals  / Nibbles & Bits  / Recipes  / Uncategorized  / Vegan  / Vegetarian

You might also like

Recipe: Special Occasion Stuffing Muffins {Vegan & High Protein}
December 2, 2019
Recipe: Caramelised Onion, Freekah and Lentil Soup
September 8, 2019
Recipe: White Bean & Kale Soup {Vegan & GF}
June 14, 2019

Leave A Reply


Leave a Reply Cancel reply

Your email address will not be published. Required fields are marked *

This site uses Akismet to reduce spam. Learn how your comment data is processed.

  • Facebook Twitter Pinterest Instagram
  • Categories

    • ASG & Marion Group
    • Beauty & Hair
    • Bitchin' In The Kitchen
    • Blog Stalking
    • Book – The Girls Guide to Survival
    • Breakfast/Brunch
    • Cakes
    • Candies/Slices/Fete Goodies
    • Cleaning
    • Cocktails
    • Cookies
    • Craftiness
    • Cupcakes
    • Dips/Sauces/Dressings
    • DIY Beauty
    • Fashion
    • Free Printables
    • Gluten Free
    • Hints & Tips
    • Hints & Tips
    • Home Decor
    • Indie Love
    • Kitchen Hints & Tips
    • Living Life with Flair
    • Main Meals
    • Markets I've Been To
    • Menus
    • Misc Savory
    • Misc Sweet
    • Mocktails
    • Nibbles & Bits
    • Personal Care
    • Product Reviews
    • Published Elsewhere
    • Recipes
    • Restaurant Ripoffs
    • Salads & Side Dishes
    • Savoury Tarts & Pies
    • Second Look Sundays
    • Sewing
    • Silhouette
    • Slow Cooker
    • Soups
    • Stains
    • Sweet Tarts & Pies
    • Uncategorized
    • Vegan
    • Vegetarian
    • Videos


  • Footer

    • Legal Info
    • Media
    • Glossary
    • Contact
  • Recent Posts

    • Halloween Recipe: Spooky Cherry Pie October 24, 2020
    • Halloween Recipe: Easy Black Cat Sandwich Cookies September 27, 2020
    • Recipe: Everything Bagel Seasoning August 18, 2020
  • Popular Posts

    • Recipe: Whole Mandarin Cake
      September 5, 2011

  • Legal Info
  • Media
  • Glossary
  • Contact